Home / Uncategorized / LL-37 (5 MG)

LL-37 (5 MG)

Price range: €43.24 through €394.67

Specification Technical Detail
Product Name LL-37 Peptide
Sequence [LL-37, 37 aa]
Molecular Formula $\text{C}_{205}\text{H}_{340}\text{N}_{60}\text{O}_{53}$
Molar Mass $4493.33\text{ g/mol}$
Purity Standard $\ge 98.0\%$ (HPLC verified)
Form Factor Lyophilized powder
Unit Dosage $5\text{ mg per vial}$
Recommended Storage Store at $-20^\circ\text{C}$ dry
SKU: N/A Category: Tags: , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,

Description

Researchers seeking premium biochemical materials can Buy LL-37 5mg Germany laboratory supply directly through Peptide Lab Europe, setting a trusted benchmark for analytical research across European institutions.

LL-37 is a well-studied human cathelicidin-derived antimicrobial peptide consisting of a 37-amino-acid sequence. Naturally generated by enzymatic cleavage from the precursor protein hCAP18, this host-defense peptide plays an integral role in native biochemical pathways and innate immunity modeling.

Our formulation yields a minimum purity of 98% validated via High-Performance Liquid Chromatography (HPLC) and Mass Spectrometry. Each 5mg vial provides precise batch-to-batch consistency designed strictly for laboratory analysis, cellular assays, and structural research application.

Mechanism of Action and Biochemical Dynamics

The biological mechanism of LL-37 centers around its amphipathic alpha-helical conformation. Containing both hydrophilic and hydrophobic residues, the sequence interacts dynamically with lipid bilayers and cell surface membranes.

       +-------------------------------------------------------+
       |           LL-37 Peptide Alpha-Helical Axis            |
       +-------------------------------------------------------+
               /                                       \
  [ Cationic Hydrophilic Face ]           [ Hydrophobic Lipophilic Face ]
               |                                       |
  Attracts negatively charged             Inserts directly into lipid
  target surface membranes                bilayers to study permeability
               \                                       /
       +-------------------------------------------------------+
       |   Membrane Neutralization & Disruption Assay Model     |
       +-------------------------------------------------------+

When deployed in vitro, LL-37 binds selectively to anionic bacterial membrane components. The cationic charge facilitates surface attachment, allowing the peptide to alter lipid arrangement, influence permeability, and mediate signaling cascades within cell cultures.

Beyond basic membrane dynamics, LL-37 acts as a chemotactic agent in tissue model systems. It interacts with specific cellular receptors, including Formyl Peptide Receptor-like 1 (FPRL1), modulating inflammatory pathways, cellular migration, and tissue remodeling mechanisms under controlled conditions.

Key Research Applications

  • Innate Immune System Modeling: Utilized to observe antimicrobial responses and host-defense mechanisms against varied microbial cell walls.

  • Cellular Signaling and Migration: Examined for its ability to chemoattract immune cells such as neutrophils, monocytes, and T-cells in assay environments.

  • Wound Healing and Tissue Repair: Studied in vascularization and re-epithelialization research models to analyze tissue regeneration pathways.

  • Biofilm Disruption Research: Evaluated for its efficacy in inhibiting initial biofilm formation and disrupting established extracellular matrices.

Quality Assurance, Storage, and Handling

To ensure maximum molecular longevity, LL-37 is reconstituted using sterile bacteriostatic water or laboratory-grade buffers. Lyophilized vials should remain stored in a dark, temperature-controlled environment at $-20^\circ\text{C}$.

Following reconstitution, store solutions between $2^\circ\text{C}$ and $8^\circ\text{C}$ for short-term evaluation, or freeze aliquots at $-80^\circ\text{C}$ to prevent degradation during repeated freeze-thaw cycles. Every batch undergoes rigorous quality assurance testing to deliver accurate, reproducible laboratory data.

Researchers looking to Buy LL-37 5mg Germany research materials can depend on our dedicated distribution network for rapid, temperature-controlled shipping throughout Europe, ensuring total structural integrity upon delivery.

Additional information

Quantity

1 Pack, 5 Packs, 10 Packs